Recombinant Human VEGFA Protein
| Cat.No. : | VEGFA-147H |
| Product Overview : | Recombinant Human Vascular Endothelial Growth Factor A is produced by our Mammalian expression system and the target gene encoding Ala27-Arg191 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Protein Length : | Ala27-Arg191 |
| Description : | Human Vascular endothelial growth factor (VEGF), also known as VEGF-A and vascular permeability factor (VPF), belongs to the platelet-derived growth factor family of cysteine-knot growth factors. It is a potent activator in vasculogenesis and angiogenesis both physiologically and pathologically. VEGF-A has 8 differently spliced isoforms, of which VEGF165 is the most abundant one. VEGF165 is a disulfide-linked homodimer consisting of two glycosylated 165 amino acid polypeptide chains. VEGF stimulates the cellular response through binding to tyrosine kinase receptors VEGFR1 and VEGFR2 on the cell surface. It is widely accepted that VEGFR2 mediate almost all of the known cellular responses to VEGF while the function of VEGFR1 is less defined and is thought to modulate the VEGFR2 signaling. |
| Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| AA Sequence : | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGL ECVPTEESNITMQIMRIK PHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKA RQLELNERTCRCDKPRR |
| Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
| Purity : | >95% |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
| Gene Name | VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ] |
| Official Symbol | VEGFA |
| Synonyms | Vascular Endothelial Growth Factor Isoform 165; VEGF165; VPF; VEGF; MVCD1 |
| Gene ID | 7422 |
| mRNA Refseq | NM_001025366.3 |
| Protein Refseq | NP_001020537.2 |
| MIM | 192240 |
| UniProt ID | P15692 |
| ◆ Recombinant Proteins | ||
| VEGFA-25H | Active Recombinant Human VEGF 162 | +Inquiry |
| VEGFA-325H | Recombinant Active Human VEGFA (VEGF165) Protein, His-tagged(C-ter) | +Inquiry |
| VEGFA-8213H | Recombinant Human VEGFA, Biotin-tagged | +Inquiry |
| VEGFA-7310HF | Recombinant Human VEGFA Protein, None-tagged, FITC conjugated | +Inquiry |
| Vegfa-436R | Recombinant Rat Vegfa protein | +Inquiry |
| ◆ Native Proteins | ||
| VEGFA-31701TH | Native Human VEGFA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
