Recombinant Human VEGFA Protein, GMP Grade, Animal-Free
| Cat.No. : | VEGFA-42HG |
| Product Overview : | GMP Recombinant Human VEGFA protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 165 amino acid |
| Description : | VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. |
| Molecular Mass : | 38.2 kDa |
| AA Sequence : | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Gene Name | VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ] |
| Official Symbol | VEGFA |
| Synonyms | VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609; |
| Gene ID | 7422 |
| mRNA Refseq | NM_001025366 |
| Protein Refseq | NP_001020537 |
| MIM | 192240 |
| UniProt ID | P15692 |
| ◆ Recombinant Proteins | ||
| VEGFA-147H | Recombinant Human VEGFA Protein | +Inquiry |
| VEGFA-6556H | Recombinant Human VEGFA Protein (Ala27-Arg191), C-His tagged | +Inquiry |
| VEGFA-959C | Recombinant Canine VEGFA protein(Met1-Arg190) | +Inquiry |
| VEGFA-549HAF555 | Recombinant Human VEGFA Protein, None-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| VEGFA-31706TH | Recombinant Human VEGFA, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| VEGFA-31701TH | Native Human VEGFA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
| VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
| VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
