Recombinant Human VEGFA Protein, GMP Grade, Animal-Free
Cat.No. : | VEGFA-42HG |
Product Overview : | GMP Recombinant Human VEGFA protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. Recombinant Human VEGF165 is a 38.2 kDa, disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 165 amino acid |
Description : | VEGF is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. |
Molecular Mass : | 38.2 kDa |
AA Sequence : | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ] |
Official Symbol | VEGFA |
Synonyms | VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609; |
Gene ID | 7422 |
mRNA Refseq | NM_001025366 |
Protein Refseq | NP_001020537 |
MIM | 192240 |
UniProt ID | P15692 |
◆ Recombinant Proteins | ||
Vegfa-5533M | Recombinant Mouse Vascular Endothelial Growth Factor A | +Inquiry |
VEGFA-648H | Active Recombinant Human VEGFA | +Inquiry |
VEGFA-31560TH | Recombinant Human VEGFA, His-tagged | +Inquiry |
VEGFA-536M | Recombinant Mouse VEGFA Protein | +Inquiry |
VEGFA-7310HF | Recombinant Human VEGFA Protein, None-tagged, FITC conjugated | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *