Recombinant Human VEGFB protein, His-SUMO-tagged
| Cat.No. : | VEGFB-6433H |
| Product Overview : | Recombinant Human VEGFB protein(P49765)(31-129aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 31-129aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.1 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK |
| Gene Name | VEGFB vascular endothelial growth factor B [ Homo sapiens ] |
| Official Symbol | VEGFB |
| Synonyms | VEGFB; vascular endothelial growth factor B; VRF; VEGFL; VEGF-related factor; |
| Gene ID | 7423 |
| mRNA Refseq | NM_001243733 |
| Protein Refseq | NP_001230662 |
| MIM | 601398 |
| UniProt ID | P49765 |
| ◆ Recombinant Proteins | ||
| VEGFB-1554H | Recombinant Human VEGFB Protein (22-207 aa), His-tagged | +Inquiry |
| VEGFB-18005M | Recombinant Mouse VEGFB Protein | +Inquiry |
| VEGFB-202H | Active Recombinant Human VEGFB | +Inquiry |
| Vegfb-254M | Active Recombinant Mouse Vegfb | +Inquiry |
| VEGFB-597D | Recombinant Dog VEGFB protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFB-416HCL | Recombinant Human VEGFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFB Products
Required fields are marked with *
My Review for All VEGFB Products
Required fields are marked with *
