Recombinant Human VEGFB protein, His-SUMO-tagged
| Cat.No. : | VEGFB-6433H | 
| Product Overview : | Recombinant Human VEGFB protein(P49765)(31-129aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 31-129aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 24.1 kDa | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK | 
| Gene Name | VEGFB vascular endothelial growth factor B [ Homo sapiens ] | 
| Official Symbol | VEGFB | 
| Synonyms | VEGFB; vascular endothelial growth factor B; VRF; VEGFL; VEGF-related factor; | 
| Gene ID | 7423 | 
| mRNA Refseq | NM_001243733 | 
| Protein Refseq | NP_001230662 | 
| MIM | 601398 | 
| UniProt ID | P49765 | 
| ◆ Recombinant Proteins | ||
| VEGFB-596C | Recombinant Cattle VEGFB protein, His & T7-tagged | +Inquiry | 
| VEGFB-6558H | Recombinant Human VEGFB Protein (Pro22-Ala207), N-His tagged | +Inquiry | 
| Vegfb-254M | Active Recombinant Mouse Vegfb | +Inquiry | 
| VEGFB-0505H | Recombinant Human VEGFB Protein (M1-A207), His/Strep tagged | +Inquiry | 
| VEGFB-640H | Recombinant Human Vascular Endothelial Growth Factor B | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| VEGFB-416HCL | Recombinant Human VEGFB 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All VEGFB Products
Required fields are marked with *
My Review for All VEGFB Products
Required fields are marked with *
  
        
    
      
            