Recombinant Human VEGFC Protein(112-227aa), GST-tagged

• Cat.No.: VEGFC-5839H
• Product Overview: Recombinant Human VEGFC Protein(112-227aa)(P49767), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 112-227aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.1kDa
• AA Sequence: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: VEGFC vascular endothelial growth factor C [ Homo sapiens ]
• Official Symbol: VEGFC
• Synonyms: VEGFC; vascular endothelial growth factor C; VRP; VEGF-C; FLT4 ligand DHM; vascular endothelial growth factor-related protein; Flt4-L
• Gene ID: 7424
• mRNA Refseq: NM_005429
• Protein Refseq: NP_005420
• MIM: 601528
• UniProt ID: P49767