Recombinant Human VEGFC Protein(112-227aa), GST-tagged
Cat.No. : | VEGFC-5839H |
Product Overview : | Recombinant Human VEGFC Protein(112-227aa)(P49767), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 112-227aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.1kDa |
AA Sequence : | AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | VEGFC vascular endothelial growth factor C [ Homo sapiens ] |
Official Symbol | VEGFC |
Synonyms | VEGFC; vascular endothelial growth factor C; VRP; VEGF-C; FLT4 ligand DHM; vascular endothelial growth factor-related protein; Flt4-L; |
Gene ID | 7424 |
mRNA Refseq | NM_005429 |
Protein Refseq | NP_005420 |
MIM | 601528 |
UniProt ID | P49767 |
◆ Recombinant Proteins | ||
VEGFC-4633H | Recombinant Human VEGFC protein, His-Avi-tagged | +Inquiry |
VEGFC-1148M | Recombinant Mouse/Rat VEGFC protein(Ala108-Arg223), His-tagged | +Inquiry |
VEGFC-5743H | Recombinant Human VEGFC protein, His-tagged | +Inquiry |
VEGFC-567H | Recombinant Human VEGFC Protein, His-tagged | +Inquiry |
Vegfc-8714R | Recombinant Rat Vegfc, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFC-2768HCL | Recombinant Human VEGFC cell lysate | +Inquiry |
VEGFC-1306RCL | Recombinant Rat VEGFC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VEGFC Products
Required fields are marked with *
My Review for All VEGFC Products
Required fields are marked with *
0
Inquiry Basket