Recombinant Human VEZT protein, His-tagged
Cat.No. : | VEZT-2457H |
Product Overview : | Recombinant Human VEZT protein(382-731 aa), fused to His tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 382-731 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VRSLQLHLKALLNEVIILEDELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLGFKASEAERQKWKQLLFSDHAVLKSLSPVDPVEPISNSEPSMNSDMGKVSKNDTEEESNKSATTDNEISRTEYLCENALEGKNKDNSSNEVFPQGAEERMCYQCESEDEPQADGSGLTTAPPTPRDSLQPSIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGDEEEEQIIEENKNEIEEK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | VEZT vezatin, adherens junctions transmembrane protein [ Homo sapiens ] |
Official Symbol | VEZT |
Synonyms | VEZT; vezatin, adherens junctions transmembrane protein; vezatin; DKFZP761C241; VEZATIN; DKFZp761C241; |
Gene ID | 55591 |
mRNA Refseq | NM_017599 |
Protein Refseq | NP_060069 |
UniProt ID | Q9HBM0 |
◆ Recombinant Proteins | ||
VEZT-371H | Recombinant Human VEZT Protein, MYC/DDK-tagged | +Inquiry |
VEZT-6519R | Recombinant Rat VEZT Protein | +Inquiry |
RFL19512XF | Recombinant Full Length Xenopus Tropicalis Vezatin(Vezt) Protein, His-Tagged | +Inquiry |
RFL30950RF | Recombinant Full Length Rat Vezatin(Vezt) Protein, His-Tagged | +Inquiry |
VEZT-10011M | Recombinant Mouse VEZT Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEZT Products
Required fields are marked with *
My Review for All VEZT Products
Required fields are marked with *