Recombinant Human VEZT protein, His-tagged
| Cat.No. : | VEZT-2457H |
| Product Overview : | Recombinant Human VEZT protein(382-731 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 382-731 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VRSLQLHLKALLNEVIILEDELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLGFKASEAERQKWKQLLFSDHAVLKSLSPVDPVEPISNSEPSMNSDMGKVSKNDTEEESNKSATTDNEISRTEYLCENALEGKNKDNSSNEVFPQGAEERMCYQCESEDEPQADGSGLTTAPPTPRDSLQPSIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGDEEEEQIIEENKNEIEEK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | VEZT vezatin, adherens junctions transmembrane protein [ Homo sapiens ] |
| Official Symbol | VEZT |
| Synonyms | VEZT; vezatin, adherens junctions transmembrane protein; vezatin; DKFZP761C241; VEZATIN; DKFZp761C241; |
| Gene ID | 55591 |
| mRNA Refseq | NM_017599 |
| Protein Refseq | NP_060069 |
| UniProt ID | Q9HBM0 |
| ◆ Recombinant Proteins | ||
| VEZT-10011M | Recombinant Mouse VEZT Protein, His (Fc)-Avi-tagged | +Inquiry |
| VEZT-2457H | Recombinant Human VEZT protein, His-tagged | +Inquiry |
| RFL18681MF | Recombinant Full Length Mouse Vezatin(Vezt) Protein, His-Tagged | +Inquiry |
| VEZT-18009M | Recombinant Mouse VEZT Protein | +Inquiry |
| Vezt-6918M | Recombinant Mouse Vezt Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEZT Products
Required fields are marked with *
My Review for All VEZT Products
Required fields are marked with *
