Recombinant Human VGLL3 Protein (1-320 aa), His-tagged

Cat.No. : VGLL3-1555H
Product Overview : Recombinant Human VGLL3 Protein (1-320 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length of Isoform 2.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-320 aa
Description : May act as a specific coactivator for the mammalian TEFs.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 37.2 kDa
AA Sequence : MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name VGLL3 vestigial like 3 (Drosophila) [ Homo sapiens ]
Official Symbol VGLL3
Synonyms VGLL3; VGL 3; vestigial-like 3; VGL3; VGL-3; FLJ38507; DKFZp686O1845;
Gene ID 389136
mRNA Refseq NM_016206
Protein Refseq NP_057290
MIM 609980
UniProt ID A8MV65

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VGLL3 Products

Required fields are marked with *

My Review for All VGLL3 Products

Required fields are marked with *

0
cart-icon