Recombinant Human VGLL3 Protein (1-320 aa), His-tagged
Cat.No. : | VGLL3-1555H |
Product Overview : | Recombinant Human VGLL3 Protein (1-320 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-320 aa |
Description : | May act as a specific coactivator for the mammalian TEFs. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.2 kDa |
AA Sequence : | MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | VGLL3 vestigial like 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | VGLL3 |
Synonyms | VGLL3; VGL 3; vestigial-like 3; VGL3; VGL-3; FLJ38507; DKFZp686O1845; |
Gene ID | 389136 |
mRNA Refseq | NM_016206 |
Protein Refseq | NP_057290 |
MIM | 609980 |
UniProt ID | A8MV65 |
◆ Recombinant Proteins | ||
VGLL3-1555H | Recombinant Human VGLL3 Protein (1-320 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VGLL3-1905HCL | Recombinant Human VGLL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VGLL3 Products
Required fields are marked with *
My Review for All VGLL3 Products
Required fields are marked with *
0
Inquiry Basket