"VIM" Related Products

Expand
Expand
Expand

Recombinant Human VIM protein, T7/His-tagged

Cat.No.: VIM-203H
Product Overview: Recombinant human VIM (465aa, derived from BC000163) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPS TSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVR FLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQRE EAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDV RQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREM EENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLN LRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: VIM vimentin [ Homo sapiens ]
Official Symbol: VIM
Synonyms: VIM; vimentin; FLJ36605;
Gene ID: 7431
mRNA Refseq: NM_003380
Protein Refseq: NP_003371
MIM:
UniProt ID: P08670
Chromosome Location: 10p13
Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptotic cleavage of cellular proteins, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; Aurora B signaling, organism-specific biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Caspase-mediated cleavage of cytoskeletal proteins, organism-specific biosystem;
Function: identical protein binding; protein C-terminus binding; protein binding; structural constituent of cytoskeleton;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.