Recombinant Human VMA21 protein, His-tagged
| Cat.No. : | VMA21-3627H |
| Product Overview : | Recombinant Human VMA21 protein(1-101 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-101 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | VMA21 |
| Synonyms | VMA21; VMA21 vacuolar H+-ATPase homolog (S. cerevisiae); MEAX, myopathy with excessive autophagy; vacuolar ATPase assembly integral membrane protein VMA21; XMEA; myopathy with excessive autophagy protein; MEAX; MGC125514; MGC125516; MGC131652; |
| Gene ID | 203547 |
| mRNA Refseq | NM_001017980 |
| Protein Refseq | NP_001017980 |
| UniProt ID | Q3ZAQ7 |
| ◆ Cell & Tissue Lysates | ||
| VMA21-403HCL | Recombinant Human VMA21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VMA21 Products
Required fields are marked with *
My Review for All VMA21 Products
Required fields are marked with *
