Recombinant Human VPS11, His-tagged

Cat.No. : VPS11-30026TH
Product Overview : Recombinant fragment, corresponding to amino acids 651-941 of Human VPS11 with an N terminal His tag. MW 36 kDa ;
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 58 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ISLLKSGRFCDVFDKALVLCQMHDFQDGVLYLYEQGKLFQ QIMHYHMQHEQYRQVISVCERHGEQDPSLWEQALSYFA RKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTA TLSVIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQE IQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQ HCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHD QFQHQLKCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLT SSLEAGLQRDLLMHSRRGT
Gene Name : VPS11 vacuolar protein sorting 11 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol : VPS11
Synonyms : VPS11; vacuolar protein sorting 11 homolog (S. cerevisiae); vacuolar protein sorting 11 (yeast homolog); vacuolar protein sorting-associated protein 11 homolog; PEP5; RNF108;
Gene ID : 55823
mRNA Refseq : NM_021729
Protein Refseq : NP_068375
MIM : 608549
Uniprot ID : Q9H270
Chromosome Location : 11q23
Function : metal ion binding; nucleotide binding; zinc ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All VPS11 Products

Required fields are marked with *

My Review for All VPS11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends