Recombinant Human VPS11, His-tagged
Cat.No. : | VPS11-30026TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 651-941 of Human VPS11 with an N terminal His tag. MW 36 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Description : | Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 58 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ISLLKSGRFCDVFDKALVLCQMHDFQDGVLYLYEQGKLFQ QIMHYHMQHEQYRQVISVCERHGEQDPSLWEQALSYFA RKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTA TLSVIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQE IQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQ HCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHD QFQHQLKCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLT SSLEAGLQRDLLMHSRRGT |
Protein length : | 651-941 |
Gene Name : | VPS11 vacuolar protein sorting 11 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol : | VPS11 |
Synonyms : | VPS11; vacuolar protein sorting 11 homolog (S. cerevisiae); vacuolar protein sorting 11 (yeast homolog); vacuolar protein sorting-associated protein 11 homolog; PEP5; RNF108; |
Gene ID : | 55823 |
mRNA Refseq : | NM_021729 |
Protein Refseq : | NP_068375 |
MIM : | 608549 |
Uniprot ID : | Q9H270 |
Chromosome Location : | 11q23 |
Function : | metal ion binding; nucleotide binding; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
VPS11-10058M | Recombinant Mouse VPS11 Protein, His (Fc)-Avi-tagged | +Inquiry |
Vps11-6930M | Recombinant Mouse Vps11 Protein, Myc/DDK-tagged | +Inquiry |
VPS11-3599Z | Recombinant Zebrafish VPS11 | +Inquiry |
VPS11-3669H | Recombinant Human VPS11, His-tagged | +Inquiry |
VPS11-18358M | Recombinant Mouse VPS11 Protein | +Inquiry |
◆ Lysates | ||
VPS11-1911HCL | Recombinant Human VPS11 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All VPS11 Products
Required fields are marked with *
My Review for All VPS11 Products
Required fields are marked with *
0
Inquiry Basket