"VPS13A" Related Products

Expand

Recombinant Human VPS13A Protein (3037-3140 aa), His-SUMO-tagged

Cat.No. : VPS13A-1890H
Product Overview : Recombinant Human VPS13A Protein (3037-3140 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
Description : May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane.
Source : E. coli
Species : Human
Tag : His-SUMO
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.5 kDa
Protein length : 3037-3140 aa
AA Sequence : RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name : VPS13A vacuolar protein sorting 13 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol : VPS13A
Synonyms : VPS13A; KIAA0986; CHAC; CHOREIN; FLJ42030;
Gene ID : 23230
mRNA Refseq : NM_001018037
Protein Refseq : NP_001018047
MIM : 605978
UniProt ID : Q96RL7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.