Recombinant Human VPS13A Protein (3037-3140 aa), His-SUMO-tagged

• Cat.No.: VPS13A-1890H
• Product Overview: Recombinant Human VPS13A Protein (3037-3140 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 3037-3140 aa
• Description: May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.5 kDa
• AA Sequence: RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: VPS13A vacuolar protein sorting 13 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: VPS13A
• Synonyms: VPS13A; KIAA0986; CHAC; CHOREIN; FLJ42030
• Gene ID: 23230
• mRNA Refseq: NM_001018037
• Protein Refseq: NP_001018047
• MIM: 605978
• UniProt ID: Q96RL7