Recombinant Human VPS13A Protein (3037-3140 aa), His-SUMO-tagged

Cat.No. : VPS13A-1890H
Product Overview : Recombinant Human VPS13A Protein (3037-3140 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 3037-3140 aa
Description : May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.5 kDa
AA Sequence : RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name VPS13A vacuolar protein sorting 13 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol VPS13A
Synonyms VPS13A; KIAA0986; CHAC; CHOREIN; FLJ42030;
Gene ID 23230
mRNA Refseq NM_001018037
Protein Refseq NP_001018047
MIM 605978
UniProt ID Q96RL7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VPS13A Products

Required fields are marked with *

My Review for All VPS13A Products

Required fields are marked with *

0
cart-icon