Recombinant Human VPS28 protein, T7-tagged

Cat.No. : VPS28-184H
Product Overview : Recombinant human VPS28 (221aa, Isoform_1) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 221 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSTSMFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAY IKDCVSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIAD VVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLF DLESAYNAFNRFLHA
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro endosomal sorting pathway regulation study with intracellular delivery methods.2. As soluble /native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping viral particle budding pathway regulation with protein–protein interaction assay.4. May be used as antigen for specific antibody development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name VPS28 vacuolar protein sorting 28 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol VPS28
Synonyms VPS28; vacuolar protein sorting 28 homolog (S. cerevisiae); vacuolar protein sorting 28 (yeast); vacuolar protein sorting-associated protein 28 homolog; H-Vps28; ESCRT-I complex subunit VPS28; yeast class E protein Vps28p homolog; MGC60323;
Gene ID 51160
mRNA Refseq NM_016208
Protein Refseq NP_057292
MIM 611952
UniProt ID Q9UK41
Chromosome Location 8q24.3
Pathway Assembly of HIV virion, organism-specific biosystem; Disease, organism-specific biosystem; ESCRT-I complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; HIV Infection, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VPS28 Products

Required fields are marked with *

My Review for All VPS28 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon