Recombinant Human VPS33B, His-tagged
| Cat.No. : | VPS33B-31739TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 406-562 of Human VPS33B with N terminal His tag; MWt 18kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 406-562 a.a. | 
| Description : | Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and encodes the human ortholog of rat Vps33b which is homologous to the yeast class C Vps33 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 95 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | TENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTE QAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSN FRAISKKLNLIPRVDGEYDLKVPRDMAYVFGGAYVPLS CRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKEDK ASS | 
| Gene Name | VPS33B vacuolar protein sorting 33 homolog B (yeast) [ Homo sapiens ] | 
| Official Symbol | VPS33B | 
| Synonyms | VPS33B; vacuolar protein sorting 33 homolog B (yeast); vacuolar protein sorting 33B (yeast homolog); vacuolar protein sorting-associated protein 33B; FLJ14848; | 
| Gene ID | 26276 | 
| mRNA Refseq | NM_018668 | 
| Protein Refseq | NP_061138 | 
| MIM | 608552 | 
| Uniprot ID | Q9H267 | 
| Chromosome Location | 15q26.1 | 
| Function | protein binding; | 
| ◆ Recombinant Proteins | ||
| VPS33B-3877H | Recombinant Human VPS33B protein, His-tagged | +Inquiry | 
| VPS33B-31739TH | Recombinant Human VPS33B, His-tagged | +Inquiry | 
| VPS33B-5610H | Recombinant Human VPS33B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| VPS33B-3677H | Recombinant Human VPS33B, GST-tagged | +Inquiry | 
| VPS33B-10066M | Recombinant Mouse VPS33B Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| VPS33B-390HCL | Recombinant Human VPS33B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VPS33B Products
Required fields are marked with *
My Review for All VPS33B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            