Recombinant Human VPS37D protein, GST-tagged
Cat.No. : | VPS37D-301475H |
Product Overview : | Recombinant Human VPS37D (91-165 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Glu91-Ala165 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | EVAENCADKLQRLEESMHRWSPHCALGWLQAELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | VPS37D vacuolar protein sorting 37 homolog D (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | VPS37D |
Synonyms | WBSCR24 |
Gene ID | 155382 |
mRNA Refseq | NM_001077621.1 |
Protein Refseq | NP_001071089.1 |
MIM | 610039 |
UniProt ID | Q86XT2 |
◆ Recombinant Proteins | ||
VPS37D-18377M | Recombinant Mouse VPS37D Protein | +Inquiry |
VPS37D-301475H | Recombinant Human VPS37D protein, GST-tagged | +Inquiry |
VPS37D-10069M | Recombinant Mouse VPS37D Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VPS37D Products
Required fields are marked with *
My Review for All VPS37D Products
Required fields are marked with *