Recombinant Human VPS54 protein, GST-tagged
Cat.No. : | VPS54-301585H |
Product Overview : | Recombinant Human VPS54 (467-719 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Val467-Val719 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | VLDKNQRTRELEEISQQKNAAKDNSLDTEVAYLIHEGMFISDAFGEGELTPIAVDTTSQRNASPNSEPCSSDSVSEPECTTDSSSSKEHTSSSAIPGGVDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGALQSQAIKFVNRFHEERKTKLSLLLDNERWKQADVPAEFQDLVDSLSDGKIALPEKKSGATEERKPAEV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | VPS54 VPS54 subunit of GARP complex [ Homo sapiens (human) ] |
Official Symbol | VPS54 |
Synonyms | WR; HCC8; SLP-8p; VPS54L; hVps54L; PPP1R164 |
Gene ID | 51542 |
mRNA Refseq | NM_001005739 |
Protein Refseq | NP_001005739 |
MIM | 614633 |
UniProt ID | Q9P1Q0 |
◆ Recombinant Proteins | ||
VPS54-4987R | Recombinant Rhesus Macaque VPS54 Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS54-6202R | Recombinant Rat VPS54 Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS54-7133Z | Recombinant Zebrafish VPS54 | +Inquiry |
VPS54-5174R | Recombinant Rhesus monkey VPS54 Protein, His-tagged | +Inquiry |
VPS54-301585H | Recombinant Human VPS54 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS54-1917HCL | Recombinant Human VPS54 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VPS54 Products
Required fields are marked with *
My Review for All VPS54 Products
Required fields are marked with *
0
Inquiry Basket