Recombinant Human VRK3 protein, His-tagged
Cat.No. : | VRK3-3010H |
Product Overview : | Recombinant Human VRK3 fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Inactive serine/threonine-protein kinase VRK3 is a 474 amino acids protein that belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family and VRK subfamily. It contains a protein kinase domain. VRK3 is widely expressed in human tissues and the protein localizes to the nucleus. VRK3 regulates several transcription factors, nuclear envelope assembly, and chromatin condensation and is also required for cell cycle progression. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
AA Sequence : | MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKW SSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSP QKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGP QKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLP SLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLA GYGFAFRYCPSGKHVAYVEGSRSPHEGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPW TNCLPNTEDIMKQKQKLPWDSFVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at< -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Gene Name | VRK3 vaccinia related kinase 3 [ Homo sapiens ] |
Official Symbol | VRK3 |
Synonyms | VRK3; vaccinia related kinase 3; inactive serine/threonine-protein kinase VRK3; vaccinia-related kinase 3; serine/threonine-protein kinase VRK3; serine/threonine-protein pseudokinase VRK3; |
Gene ID | 51231 |
mRNA Refseq | NM_001025778 |
Protein Refseq | NP_001020949 |
MIM | |
UniProt ID | Q8IV63 |
Chromosome Location | 19q13.33 |
Function | ATP binding; nucleotide binding; protein kinase activity; protein phosphatase binding; transferase activity, transferring phosphorus-containing groups; |
◆ Recombinant Proteins | ||
VRK3-2221Z | Recombinant Zebrafish VRK3 | +Inquiry |
VRK3-0561H | Recombinant Human VRK3 Protein (I2-P474), Tag Free | +Inquiry |
VRK3-3634H | Recombinant Human VRK3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VRK3-3688H | Recombinant Human VRK3 protein, His-tagged | +Inquiry |
VRK3-31742TH | Recombinant Human VRK3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
VRK3-380HCL | Recombinant Human VRK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VRK3 Products
Required fields are marked with *
My Review for All VRK3 Products
Required fields are marked with *