Recombinant Human VRK3 protein, His-tagged
Cat.No. : | VRK3-3688H |
Product Overview : | Recombinant Human VRK3 protein(1-301 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-301 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | VRK3 vaccinia related kinase 3 [ Homo sapiens ] |
Official Symbol | VRK3 |
Synonyms | VRK3; vaccinia related kinase 3; inactive serine/threonine-protein kinase VRK3; vaccinia-related kinase 3; serine/threonine-protein kinase VRK3; serine/threonine-protein pseudokinase VRK3; |
Gene ID | 51231 |
mRNA Refseq | NM_001025778 |
Protein Refseq | NP_001020949 |
UniProt ID | Q8IV63 |
◆ Recombinant Proteins | ||
VRK3-268H | Recombinant Human VRK3, GST-tagged | +Inquiry |
VRK3-3010H | Recombinant Human VRK3 protein, His-tagged | +Inquiry |
VRK3-3634H | Recombinant Human VRK3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VRK3-0562H | Recombinant Human VRK3 Protein (I2-P474), His/GST tagged | +Inquiry |
VRK3-31742TH | Recombinant Human VRK3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
VRK3-380HCL | Recombinant Human VRK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VRK3 Products
Required fields are marked with *
My Review for All VRK3 Products
Required fields are marked with *