Recombinant Human VSIG4 Protein, Fc-tagged
Cat.No. : | VSIG4-055H |
Product Overview : | Recombinant Human VSIG4 fused with Fc His tag at C-termina was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for the complement component 3 fragments C3b and iC3b. Alternate splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Molecular Mass : | 56.3kD |
AA Sequence : | RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | VSIG4 V-set and immunoglobulin domain containing 4 [ Homo sapiens ] |
Official Symbol | VSIG4 |
Synonyms | VSIG4; V-set and immunoglobulin domain containing 4; V-set and immunoglobulin domain-containing protein 4; Z39IG; protein Z39Ig; Ig superfamily protein; complement receptor of the immunoglobulin superfamily; CRIg; |
Gene ID | 11326 |
mRNA Refseq | NM_001100431 |
Protein Refseq | NP_001093901 |
MIM | 300353 |
UniProt ID | Q9Y279 |
◆ Recombinant Proteins | ||
VSIG4-3955H | Recombinant Human VSIG4 protein(Met1-Pro283), His-tagged | +Inquiry |
VSIG4-055H | Recombinant Human VSIG4 Protein, Fc-tagged | +Inquiry |
VSIG4-301419H | Recombinant Human VSIG4 protein, GST-tagged | +Inquiry |
VSIG4-0817H | Recombinant Human VSIG4 protein, His-tagged | +Inquiry |
Vsig4-122M | Recombinant Mouse Vsig4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSIG4-1092HCL | Recombinant Human VSIG4 cell lysate | +Inquiry |
VSIG4-2519MCL | Recombinant Mouse VSIG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VSIG4 Products
Required fields are marked with *
My Review for All VSIG4 Products
Required fields are marked with *
0
Inquiry Basket