Recombinant Human VSNL1 protein, GST-tagged

• Cat.No.: VSNL1-3757H
• Product Overview: Recombinant Human VSNL1 protein(P62760)(1-191aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-191aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49 kDa
• AA Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: VSNL1 visinin-like 1 [ Homo sapiens ]
• Official Symbol: VSNL1
• Synonyms: VSNL1; visinin-like 1; visinin-like protein 1; hippocalcin like protein 3; HLP3; HPCAL3; HUVISL1; VILIP; VILIP 1; VLP-1; hippocalcin-like protein 3; VILIP-1
• Gene ID: 7447
• mRNA Refseq: NM_003385
• Protein Refseq: NP_003376
• MIM: 600817
• UniProt ID: P62760