Recombinant Human VSX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : VSX1-3188H
Product Overview : VSX1 MS Standard C13 and N15-labeled recombinant protein (NP_955457) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. The encoded protein may regulate expression of the cone opsin genes early in development. Mutations in this gene can cause posterior polymorphous corneal dystrophy and keratoconus. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Mass : 24.8 kDa
AA Sequence : MTGRDSLSDGRTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPAPAGPGQGSGCEGPAVAPCPGPGLDGSSLARGALPLGLGLLCGFGTQPPAAARAPCLLLADVPFLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVSGVPFLRSKDTTENVSFPHSVSQSAVPSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name VSX1 visual system homeobox 1 [ Homo sapiens (human) ]
Official Symbol VSX1
Synonyms VSX1; visual system homeobox 1; posterior polymorphous corneal dystrophy, PPCD, visual system homeobox 1 homolog, CHX10 like (zebrafish); PPD; homeodomain protein RINX; transcription factor VSX1; retinal inner nuclear layer homeobox protein; KTCN; PPCD; RINX; KTCN1; CAASDS;
Gene ID 30813
mRNA Refseq NM_199425
Protein Refseq NP_955457
MIM 605020
UniProt ID Q9NZR4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VSX1 Products

Required fields are marked with *

My Review for All VSX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon