Recombinant Human VSX2 Protein, GST-tagged

Cat.No. : VSX2-1353H
Product Overview : Human CHX10 full-length ORF ( NP_878314.1, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in this gene are associated with microphthalmia, cataracts and iris abnormalities. [provided by RefSeq, Oct 2009]
Molecular Mass : 65.8 kDa
AA Sequence : MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name VSX2 visual system homeobox 2 [ Homo sapiens ]
Official Symbol VSX2
Synonyms VSX2; visual system homeobox 2; C elegans ceh 10 homeo domain containing homolog , ceh 10 homeo domain containing homolog (C. elegans) , ceh 10 homeodomain containing homolog (C. elegans) , CHX10, HOX10; RET1; homeobox protein CHX10; ceh-10 homeodomain-containing homolog; ceh-10 homeo domain containing homolog; CHX10; HOX10; MCOP2; MCOPCB3;
Gene ID 338917
mRNA Refseq NM_182894
Protein Refseq NP_878314
MIM 142993
UniProt ID P58304

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VSX2 Products

Required fields are marked with *

My Review for All VSX2 Products

Required fields are marked with *

0
cart-icon
0
compare icon