"VTN" Related Products

Expand
Expand

Recombinant Human VTN protein

Cat.No.: VTN-239H
Product Overview: Recombinant human Vitronectin gene (20-398 aa Fragment) was expressed in E. coli.
Source: E. coli
Species: Human
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity: Functional Test: Each lot was tested with human ES cell (H1) culture using 5-10 µg in 1 ml Nutristem medium per well (6-well plate).
AA Sequence: MDQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQV GGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLK NGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNI SDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFE LLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNS RRPSR
Purity: >95% by SDS-PAGE.
Applications: 1. As coating matrix protein for maintaining long-term ES or iPS cell culture before combining with E8 culture medium.2. As an excellent coating matrix material of 11R-tagged recombinant TF intracellular delivery for protein derived iPS protocol with extremely low-level non-specific interaction.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: VTN vitronectin [ Homo sapiens ]
Official Symbol: VTN
Synonyms: VTN; vitronectin; vitronectin (serum spreading factor, somatomedin B, complement S protein); complement S protein; serum spreading factor; somatomedin B; VN; epibolin; S-protein; complement S-protein; serum-spreading factor; V75; VNT;
Gene ID: 7448
mRNA Refseq: NM_000638
Protein Refseq: NP_000629
MIM: 193190
UniProt ID: P04004
Chromosome Location: 17q11.2
Pathway: ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Inflammatory Response Pathway, organism-specific biosystem;
Function: extracellular matrix binding; heparin binding; integrin binding; polysaccharide binding; scavenger receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.