Recombinant Human VWC2L Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : VWC2L-1527H
Product Overview : VWC2L MS Standard C13 and N15-labeled recombinant protein (NP_001073969) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : VWC2L (Von Willebrand Factor C Domain Containing 2 Like) is a Protein Coding gene. Diseases associated with VWC2L include Spinocerebellar Ataxia 36 and Mental Retardation, Enteropathy, Deafness, Peripheral Neuropathy, Ichthyosis, And Keratoderma. An important paralog of this gene is VWC2.
Molecular Mass : 24.4 kDa
AA Sequence : MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name VWC2L von Willebrand factor C domain containing 2 like [ Homo sapiens (human) ]
Official Symbol VWC2L
Synonyms VWC2L; von Willebrand factor C domain containing 2 like; von Willebrand factor C domain-containing protein 2-like; brorin-like; von Willebrand factor C domain containing protein 2 like
Gene ID 402117
mRNA Refseq NM_001080500
Protein Refseq NP_001073969
UniProt ID B2RUY7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VWC2L Products

Required fields are marked with *

My Review for All VWC2L Products

Required fields are marked with *

0
cart-icon
0
compare icon