Recombinant Human WARS Protein, His-tagged

Cat.No. : WARS-164H
Product Overview : Recombinant Human WARS, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.
Form : Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, 100mM NaCl, 1mM DTT, 10% Glycerol, pH8.0
Molecular Mass : 55kD
AA Sequence : MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVS LKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSS KIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLI PFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKT
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name WARS tryptophanyl-tRNA synthetase [ Homo sapiens ]
Official Symbol WARS
Synonyms WARS; tryptophanyl-tRNA synthetase; IFI53; tryptophan--tRNA ligase, cytoplasmic; IFP53; tryptophan tRNA ligase 1; cytoplasmic; hWRS; trpRS; interferon-induced protein 53; tryptophan tRNA ligase 1, cytoplasmic; GAMMA-2;
Gene ID 7453
mRNA Refseq NM_004184
Protein Refseq NP_004175
MIM 191050
UniProt ID P23381

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WARS Products

Required fields are marked with *

My Review for All WARS Products

Required fields are marked with *

0
cart-icon
0
compare icon