Recombinant Human WARS Protein, His-tagged
Cat.No. : | WARS-164H |
Product Overview : | Recombinant Human WARS, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene. |
Form : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, 100mM NaCl, 1mM DTT, 10% Glycerol, pH8.0 |
Molecular Mass : | 55kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVS LKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSS KIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLI PFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKT |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | WARS tryptophanyl-tRNA synthetase [ Homo sapiens ] |
Official Symbol | WARS |
Synonyms | WARS; tryptophanyl-tRNA synthetase; IFI53; tryptophan--tRNA ligase, cytoplasmic; IFP53; tryptophan tRNA ligase 1; cytoplasmic; hWRS; trpRS; interferon-induced protein 53; tryptophan tRNA ligase 1, cytoplasmic; GAMMA-2; |
Gene ID | 7453 |
mRNA Refseq | NM_004184 |
Protein Refseq | NP_004175 |
MIM | 191050 |
UniProt ID | P23381 |
◆ Recombinant Proteins | ||
WARS-2410H | Recombinant Human WARS Protein (2-471 aa), His-Myc-tagged | +Inquiry |
WARS-6570H | Recombinant Human WARS Protein (Phe247-Lys458), His tagged | +Inquiry |
Wars-1739M | Recombinant Mouse Wars protein, His & T7-tagged | +Inquiry |
WARS-165H | Recombinant Human WARS Protein, His-tagged | +Inquiry |
WARS-18424M | Recombinant Mouse WARS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WARS-001HCL | Recombinant Human WARS cell lysate | +Inquiry |
WARS-370HCL | Recombinant Human WARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WARS Products
Required fields are marked with *
My Review for All WARS Products
Required fields are marked with *