Recombinant Human WARS Protein, His-tagged

• Cat.No.: WARS-164H
• Product Overview: Recombinant Human WARS, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.
• Form: Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, 100mM NaCl, 1mM DTT, 10% Glycerol, pH8.0
• Molecular Mass: 55kD
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVS LKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSS KIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLI PFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKT
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: WARS tryptophanyl-tRNA synthetase [ Homo sapiens ]
• Official Symbol: WARS
• Synonyms: WARS; tryptophanyl-tRNA synthetase; IFI53; tryptophan--tRNA ligase, cytoplasmic; IFP53; tryptophan tRNA ligase 1; cytoplasmic; hWRS; trpRS; interferon-induced protein 53; tryptophan tRNA ligase 1, cytoplasmic; GAMMA-2
• Gene ID: 7453
• mRNA Refseq: NM_004184
• Protein Refseq: NP_004175
• MIM: 191050
• UniProt ID: P23381