Recombinant Human WAS protein family, member 1 Protein, His-tagged

Cat.No. : WASF1-001H
Product Overview : Recombinant Human WAS protein family, member 1 Protein (1-250 aa) with His tag was expressed in E. coli.
Availability September 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-250 aa
Description : The protein encoded by this gene, a member of the Wiskott-Aldrich syndrome protein (WASP)-family, plays a critical role downstream of Rac, a Rho-family small GTPase, in regulating the actin cytoskeleton required for membrane ruffling. It has been shown to associate with an actin nucleation core Arp2/3 complex while enhancing actin polymerization in vitro. Wiskott-Aldrich syndrome is a disease of the immune system, likely due to defects in regulation of actin cytoskeleton. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Tag : His
Molecular Mass : 30 kDa
AA Sequence : MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 0.5% SKL
Concentration : 1 mg/mL by BCA
Gene Name WASF1 WAS protein family, member 1 [ Homo sapiens (human) ]
Official Symbol WASF1
Synonyms WASF1; WAS protein family, member 1; wiskott-Aldrich syndrome protein family member 1; KIAA0269; SCAR1; WAVE; WAVE1; protein WAVE-1; WASP family protein member 1; homology of dictyostelium scar 1; verprolin homology domain-containing protein 1; FLJ31482
Gene ID 8936
mRNA Refseq NM_001024934
Protein Refseq NP_001020105
MIM 605035
UniProt ID Q92558

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WASF1 Products

Required fields are marked with *

My Review for All WASF1 Products

Required fields are marked with *

0
cart-icon