Recombinant Human WAS protein family, member 1 Protein, His-tagged

• Cat.No.: WASF1-001H
• Product Overview: Recombinant Human WAS protein family, member 1 Protein (1-250 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-250 aa
• Description: The protein encoded by this gene, a member of the Wiskott-Aldrich syndrome protein (WASP)-family, plays a critical role downstream of Rac, a Rho-family small GTPase, in regulating the actin cytoskeleton required for membrane ruffling. It has been shown to associate with an actin nucleation core Arp2/3 complex while enhancing actin polymerization in vitro. Wiskott-Aldrich syndrome is a disease of the immune system, likely due to defects in regulation of actin cytoskeleton. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Tag: His
• Molecular Mass: 30 kDa
• AA Sequence: MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 0.5% SKL
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: WASF1 WAS protein family, member 1 [ Homo sapiens (human) ]
• Official Symbol: WASF1
• Synonyms: WASF1; WAS protein family, member 1; wiskott-Aldrich syndrome protein family member 1; KIAA0269; SCAR1; WAVE; WAVE1; protein WAVE-1; WASP family protein member 1; homology of dictyostelium scar 1; verprolin homology domain-containing protein 1; FLJ31482
• Gene ID: 8936
• mRNA Refseq: NM_001024934
• Protein Refseq: NP_001020105
• MIM: 605035
• UniProt ID: Q92558