Recombinant Human WAS protein family, member 1 Protein, His-tagged
Cat.No. : | WASF1-001H |
Product Overview : | Recombinant Human WAS protein family, member 1 Protein (1-250 aa) with His tag was expressed in E. coli. |
Availability | May 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-250 aa |
Description : | The protein encoded by this gene, a member of the Wiskott-Aldrich syndrome protein (WASP)-family, plays a critical role downstream of Rac, a Rho-family small GTPase, in regulating the actin cytoskeleton required for membrane ruffling. It has been shown to associate with an actin nucleation core Arp2/3 complex while enhancing actin polymerization in vitro. Wiskott-Aldrich syndrome is a disease of the immune system, likely due to defects in regulation of actin cytoskeleton. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Tag : | His |
Molecular Mass : | 30 kDa |
AA Sequence : | MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 0.5% SKL |
Concentration : | 1 mg/mL by BCA |
Gene Name | WASF1 WAS protein family, member 1 [ Homo sapiens (human) ] |
Official Symbol | WASF1 |
Synonyms | WASF1; WAS protein family, member 1; wiskott-Aldrich syndrome protein family member 1; KIAA0269; SCAR1; WAVE; WAVE1; protein WAVE-1; WASP family protein member 1; homology of dictyostelium scar 1; verprolin homology domain-containing protein 1; FLJ31482 |
Gene ID | 8936 |
mRNA Refseq | NM_001024934 |
Protein Refseq | NP_001020105 |
MIM | 605035 |
UniProt ID | Q92558 |
◆ Recombinant Proteins | ||
WASF1-001H | Recombinant Human WAS protein family, member 1 Protein, His-tagged | +Inquiry |
WASF1-6558R | Recombinant Rat WASF1 Protein | +Inquiry |
WASF1-18426M | Recombinant Mouse WASF1 Protein | +Inquiry |
WASF1-6214R | Recombinant Rat WASF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
WASF1-10106M | Recombinant Mouse WASF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WASF1-368HCL | Recombinant Human WASF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WASF1 Products
Required fields are marked with *
My Review for All WASF1 Products
Required fields are marked with *
0
Inquiry Basket