Recombinant Human WASP actin nucleation promoting factor Protein, His tagged

Cat.No. : WAS-001H
Product Overview : Recombinant Human WAS Protein (230-310aa) with His tag was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 230-310aa
Description : The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. Wiskott-Aldrich syndrome is a rare, inherited, X-linked, recessive disease characterized by immune dysregulation and microthrombocytopenia, and is caused by mutations in the WAS gene. The WAS gene product is a cytoplasmic protein, expressed exclusively in hematopoietic cells, which show signalling and cytoskeletal abnormalities in WAS patients. A transcript variant arising as a result of alternative promoter usage, and containing a different 5'' UTR sequence, has been described, however, its full-length nature is not known.
Tag : C-His
Molecular Mass : 10 kDa
AA Sequence : MKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol
Concentration : 1 mg/mL by BCA
Gene Name WAS WASP actin nucleation promoting factor [ Homo sapiens (human) ]
Official Symbol WAS
Synonyms WAS; WASP actin nucleation promoting factor; THC; IMD2; SCNX; THC1; WASP; WASPA; actin nucleation-promoting factor WAS; eczema-thrombocytopenia; thrombocytopenia 1 (X-linked); wiskott-Aldrich syndrome protein
Gene ID 7454
mRNA Refseq NM_000377
Protein Refseq NP_000368
MIM 300392
UniProt ID P42768

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WAS Products

Required fields are marked with *

My Review for All WAS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon