Recombinant Human WASP actin nucleation promoting factor Protein, His tagged
| Cat.No. : | WAS-001H |
| Product Overview : | Recombinant Human WAS Protein (230-310aa) with His tag was expressed in E. coli. |
| Availability | January 14, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 230-310aa |
| Description : | The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. Wiskott-Aldrich syndrome is a rare, inherited, X-linked, recessive disease characterized by immune dysregulation and microthrombocytopenia, and is caused by mutations in the WAS gene. The WAS gene product is a cytoplasmic protein, expressed exclusively in hematopoietic cells, which show signalling and cytoskeletal abnormalities in WAS patients. A transcript variant arising as a result of alternative promoter usage, and containing a different 5'' UTR sequence, has been described, however, its full-length nature is not known. |
| Tag : | C-His |
| Molecular Mass : | 10 kDa |
| AA Sequence : | MKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | WAS WASP actin nucleation promoting factor [ Homo sapiens (human) ] |
| Official Symbol | WAS |
| Synonyms | WAS; WASP actin nucleation promoting factor; THC; IMD2; SCNX; THC1; WASP; WASPA; actin nucleation-promoting factor WAS; eczema-thrombocytopenia; thrombocytopenia 1 (X-linked); wiskott-Aldrich syndrome protein |
| Gene ID | 7454 |
| mRNA Refseq | NM_000377 |
| Protein Refseq | NP_000368 |
| MIM | 300392 |
| UniProt ID | P42768 |
| ◆ Recombinant Proteins | ||
| WAS-139H | Recombinant Human WAS Protein, MYC/DDK-tagged | +Inquiry |
| WAS-2352H | Recombinant Human WAS Protein, His (Fc)-Avi-tagged | +Inquiry |
| Was-6962M | Recombinant Mouse Was Protein, Myc/DDK-tagged | +Inquiry |
| WAS-001H | Recombinant Human WASP actin nucleation promoting factor Protein, His tagged | +Inquiry |
| Was-1970R | Recombinant Rat Was protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WAS-734HCL | Recombinant Human WAS lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WAS Products
Required fields are marked with *
My Review for All WAS Products
Required fields are marked with *
