Recombinant Human WBP2NL Protein, GST-tagged

Cat.No. : WBP2NL-4337H
Product Overview : Human MGC26816 full-length ORF ( AAH22546, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]).[supplied by OMIM
Molecular Mass : 59.73 kDa
AA Sequence : MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPSASSSQVHS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name WBP2NL WBP2 N-terminal like [ Homo sapiens ]
Official Symbol WBP2NL
Synonyms WBP2NL; WBP2 N-terminal like; postacrosomal sheath WW domain-binding protein; FLJ26145; MGC26816; PAWP; postacrosomal sheath WW domain binding protein; WW domain-binding protein 2-like;
Gene ID 164684
mRNA Refseq NM_152613
Protein Refseq NP_689826
MIM 610981
UniProt ID Q6ICG8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WBP2NL Products

Required fields are marked with *

My Review for All WBP2NL Products

Required fields are marked with *

0
cart-icon