Recombinant Full Length Human WBP2NL Protein, GST-tagged
Cat.No. : | WBP2NL-6167HF |
Product Overview : | Human MGC26816 full-length ORF ( AAH22546, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 309 amino acids |
Description : | WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]).[supplied by OMIM |
Molecular Mass : | 59.73 kDa |
AA Sequence : | MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPSASSSQVHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | WBP2NL WBP2 N-terminal like [ Homo sapiens ] |
Official Symbol | WBP2NL |
Synonyms | WBP2NL; WBP2 N-terminal like; postacrosomal sheath WW domain-binding protein; FLJ26145; MGC26816; PAWP; postacrosomal sheath WW domain binding protein; WW domain-binding protein 2-like; |
Gene ID | 164684 |
mRNA Refseq | NM_152613 |
Protein Refseq | NP_689826 |
MIM | 610981 |
UniProt ID | Q6ICG8 |
◆ Recombinant Proteins | ||
WBP2NL-10106Z | Recombinant Zebrafish WBP2NL | +Inquiry |
WBP2NL-1247H | Recombinant Human WBP2NL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WBP2NL-4337H | Recombinant Human WBP2NL Protein, GST-tagged | +Inquiry |
Wbp2nl-6967M | Recombinant Mouse Wbp2nl Protein, Myc/DDK-tagged | +Inquiry |
WBP2NL-6167HF | Recombinant Full Length Human WBP2NL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WBP2NL-365HCL | Recombinant Human WBP2NL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WBP2NL Products
Required fields are marked with *
My Review for All WBP2NL Products
Required fields are marked with *