Recombinant Human WBSCR22 protein, GST-tagged

Cat.No. : WBSCR22-7843H
Product Overview : Recombinant Human WBSCR22 protein(1-142 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-142 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAKRL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol WBSCR22
Synonyms WBSCR22; Williams Beuren syndrome chromosome region 22; uncharacterized methyltransferase WBSCR22; MGC2022; MGC5140; MGC19709; PP3381; WBMT; Williams-Beuren syndrome chromosomal region 22 protein; Williams-Beuren candidate region putative methyltransferase; HUSSY-3; HASJ4442; FLJ44236;
Gene ID 114049
mRNA Refseq NM_001202560
Protein Refseq NP_001189489
UniProt ID O43709

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WBSCR22 Products

Required fields are marked with *

My Review for All WBSCR22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon