Recombinant Human WBSCR22 protein, GST-tagged

• Cat.No.: WBSCR22-7843H
• Product Overview: Recombinant Human WBSCR22 protein(1-142 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-142 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAKRL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: WBSCR22
• Synonyms: WBSCR22; Williams Beuren syndrome chromosome region 22; uncharacterized methyltransferase WBSCR22; MGC2022; MGC5140; MGC19709; PP3381; WBMT; Williams-Beuren syndrome chromosomal region 22 protein; Williams-Beuren candidate region putative methyltransferase; HUSSY-3; HASJ4442; FLJ44236
• Gene ID: 114049
• mRNA Refseq: NM_001202560
• Protein Refseq: NP_001189489
• UniProt ID: O43709