Recombinant Human WDR1 protein(11-260 aa), N-MBP & C-His-tagged
| Cat.No. : | WDR1-2481H |
| Product Overview : | Recombinant Human WDR1 protein(O75083)(11-260 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&MBP |
| Protein Length : | 11-260 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKI |
| Gene Name | WDR1 WD repeat domain 1 [ Homo sapiens ] |
| Official Symbol | WDR1 |
| Synonyms | WDR1; WD repeat domain 1; WD repeat-containing protein 1; actin-interacting protein 1; AIP1; NORI-1; |
| Gene ID | 9948 |
| mRNA Refseq | NM_005112 |
| Protein Refseq | NP_005103 |
| MIM | 604734 |
| UniProt ID | O75083 |
| ◆ Recombinant Proteins | ||
| WDR1-2481H | Recombinant Human WDR1 protein(11-260 aa), N-MBP & C-His-tagged | +Inquiry |
| WDR1-18449M | Recombinant Mouse WDR1 Protein | +Inquiry |
| WDR1-6564R | Recombinant Rat WDR1 Protein | +Inquiry |
| WDR1-1220C | Recombinant Chicken WDR1 | +Inquiry |
| WDR1-2482H | Recombinant Human WDR1 protein(11-260 aa), N-SUMO & N-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WDR1-357HCL | Recombinant Human WDR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDR1 Products
Required fields are marked with *
My Review for All WDR1 Products
Required fields are marked with *
