Recombinant Human WDR1 Protein (189-461 aa), GST-tagged
Cat.No. : | WDR1-1213H |
Product Overview : | Recombinant Human WDR1 Protein (189-461 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 189-461 aa |
Description : | Induces disassbly of actin filaments in conjunction with ADF/cofilin family proteins. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 56.4 kDa |
AA Sequence : | SRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | WDR1 WD repeat domain 1 [ Homo sapiens ] |
Official Symbol | WDR1 |
Synonyms | WDR1; WD repeat domain 1; AIP1; NORI-1; |
Gene ID | 9948 |
mRNA Refseq | NM_005112 |
Protein Refseq | NP_005103 |
MIM | 604734 |
UniProt ID | O75083 |
◆ Recombinant Proteins | ||
WDR1-2482H | Recombinant Human WDR1 protein(11-260 aa), N-SUMO & N-His-tagged | +Inquiry |
WDR1-1220C | Recombinant Chicken WDR1 | +Inquiry |
WDR1-1213H | Recombinant Human WDR1 Protein (189-461 aa), GST-tagged | +Inquiry |
WDR1-10119M | Recombinant Mouse WDR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR1-6220R | Recombinant Rat WDR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR1-357HCL | Recombinant Human WDR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDR1 Products
Required fields are marked with *
My Review for All WDR1 Products
Required fields are marked with *