Recombinant Human WDR1 Protein (189-461 aa), GST-tagged

• Cat.No.: WDR1-1213H
• Product Overview: Recombinant Human WDR1 Protein (189-461 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 189-461 aa
• Description: Induces disassbly of actin filaments in conjunction with ADF/cofilin family proteins.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 56.4 kDa
• AA Sequence: SRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: WDR1 WD repeat domain 1 [ Homo sapiens ]
• Official Symbol: WDR1
• Synonyms: WDR1; WD repeat domain 1; AIP1; NORI-1
• Gene ID: 9948
• mRNA Refseq: NM_005112
• Protein Refseq: NP_005103
• MIM: 604734
• UniProt ID: O75083