"WDR1" Related Products

Expand

Recombinant Human WDR1 Protein (189-461 aa), GST-tagged

Cat.No. : WDR1-1213H
Product Overview : Recombinant Human WDR1 Protein (189-461 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
Description : Induces disassbly of actin filaments in conjunction with ADF/cofilin family proteins.
Source : E. coli
Species : Human
Tag : GST
Form : Tris-based buffer,50% glycerol
Molecular Mass : 56.4 kDa
Protein length : 189-461 aa
AA Sequence : SRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name : WDR1 WD repeat domain 1 [ Homo sapiens ]
Official Symbol : WDR1
Synonyms : WDR1; WD repeat domain 1; AIP1; NORI-1;
Gene ID : 9948
mRNA Refseq : NM_005112
Protein Refseq : NP_005103
MIM : 604734
UniProt ID : O75083

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.