Recombinant Human WDR6 protein, His-tagged
Cat.No. : | WDR6-3721H |
Product Overview : | Recombinant Human WDR6 protein(NP_001307475.1)(833-1121 aa) was expressed in E. coli with a N-terminal His Tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 833-1121 aa |
Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. The encoded protein interacts with serine/threonine kinase 11, and is implicated in cell growth arrest. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Bio-activity : | Not tested. |
AA Sequence : | MHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Applications : | Blocking peptide |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | WDR6 WD repeat domain 6 [Homo sapiens (human)] |
Official Symbol | WDR6 |
Synonyms | FLJ10218; FLJ52552; FLJ56107; MGC126756; MGC142027 |
Gene ID | 11180 |
mRNA Refseq | NM_001320546.3 |
Protein Refseq | NP_001307475.1 |
MIM | 606031 |
UniProt ID | Q9NNW5 |
◆ Recombinant Proteins | ||
WDR6-6572R | Recombinant Rat WDR6 Protein | +Inquiry |
WDR6-3721H | Recombinant Human WDR6 protein, His-tagged | +Inquiry |
WDR6-6228R | Recombinant Rat WDR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR6-5016R | Recombinant Rhesus Macaque WDR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR6-5203R | Recombinant Rhesus monkey WDR6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR6-736HCL | Recombinant Human WDR6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDR6 Products
Required fields are marked with *
My Review for All WDR6 Products
Required fields are marked with *