Recombinant Human WDR73 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | WDR73-1618H |
Product Overview : | WDR73 MS Standard C13 and N15-labeled recombinant protein (NP_116245) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Myc&DDK |
Description : | The protein encoded by this gene is thought to contain multiple WD40 repeats. WD40 repeats are motifs that contain 40-60 amino acids, and usually end with Trp-Asp (WD). This protein is found in the cytoplasm during interphase, but accumulates at the spindle poles and astral microtubules during mitosis. Reduced expression of this gene results in abnormalities in the size and morphology of the nucleus. Mutations in this gene have been associated with Galloway-Mowat syndrome PMID: 25466283), which is a rare autosomal recessive disorder that affects both the central nervous system and kidneys. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 41.7 kDa |
AA Sequence : | MDPGDDWLVESLRLYQDFYAFDLSGATRVLEWIDDKGVFVAGYESLKKNEILHLKLPLRLSVKENKGLFPERDFKVRHGGFSDRSIFDLKHVPHTRLLVTSGLPGCYLQVWQVAEDSDVIKAVSTIAVHEKEESLWPRVAVFSTLAPGVLHGARLRSLQVVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKWAPLENRSPGPGSGGERWCAEVGSWGQGPGPSIASLGSDGRLCLLDPRDLCHPVSSVQCPVSVPSPDPELLRVTWAPGLKNCLAISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDWVDLCAPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | WDR73 WD repeat domain 73 [ Homo sapiens (human) ] |
Official Symbol | WDR73 |
Synonyms | WDR73; WD repeat domain 73; WD repeat-containing protein 73; FLJ14888; HSPC264; FLJ00296 protein; |
Gene ID | 84942 |
mRNA Refseq | NM_032856 |
Protein Refseq | NP_116245 |
MIM | 616144 |
UniProt ID | Q6P4I2 |
◆ Recombinant Proteins | ||
RFL27826OF | Recombinant Full Length Rabbit Calcitonin Receptor(Calcr) Protein, His-Tagged | +Inquiry |
ARNTL-247H | Recombinant Human ARNTL Protein, His-tagged | +Inquiry |
KLF4-3260H | Recombinant Human KLF4 Protein (Leu352-Phe513), N-His tagged | +Inquiry |
PLXNB2B-7827Z | Recombinant Zebrafish PLXNB2B | +Inquiry |
ULK1-568H | Recombinant Human ULK1 protein, FLAG-tagged | +Inquiry |
◆ Native Proteins | ||
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
CTSG-1649H | Active Native Human CTSG protein | +Inquiry |
HbA1c-21R | Native Rhesus monkey Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAAA-2127HCL | Recombinant Human NAAA cell lysate | +Inquiry |
MAP2K4-557MCL | Recombinant Mouse MAP2K4 cell lysate | +Inquiry |
C7orf29-7970HCL | Recombinant Human C7orf29 293 Cell Lysate | +Inquiry |
PLA2G10-3145HCL | Recombinant Human PLA2G10 293 Cell Lysate | +Inquiry |
ANG-20HCL | Recombinant Human ANG lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WDR73 Products
Required fields are marked with *
My Review for All WDR73 Products
Required fields are marked with *
0
Inquiry Basket