Recombinant Human WDR83 Protein, GST-tagged
Cat.No. : | WDR83-5286H |
Product Overview : | Human MGC4238 partial ORF ( NP_115708, 171 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the WD-40 protein family. The protein is proposed to function as a molecular scaffold for various multimeric protein complexes. The protein associates with several components of the extracellular signal-regulated kinase (ERK) pathway, and promotes ERK activity in response to serum or other signals. The protein also interacts with egl nine homolog 3 (EGLN3, also known as PHD3) and regulates expression of hypoxia-inducible factor 1, and has been purified as part of the spliceosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 35.86 kDa |
AA Sequence : | VDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | WDR83 WD repeat domain 83 [ Homo sapiens (human) ] |
Official Symbol | WDR83 |
Synonyms | WDR83; WD repeat domain 83; MORG1; WD repeat domain-containing protein 83; MAPK organizer 1; mitogen-activated protein kinase organizer 1 |
Gene ID | 84292 |
mRNA Refseq | NM_001099737 |
Protein Refseq | NP_001093207 |
MIM | 616850 |
UniProt ID | Q9BRX9 |
◆ Recombinant Proteins | ||
WDR83-5207R | Recombinant Rhesus monkey WDR83 Protein, His-tagged | +Inquiry |
WDR83-5983H | Recombinant Human WDR83 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WDR83-6235R | Recombinant Rat WDR83 Protein, His (Fc)-Avi-tagged | +Inquiry |
Wdr83-6988M | Recombinant Mouse Wdr83 Protein, Myc/DDK-tagged | +Inquiry |
WDR83-1629HFL | Recombinant Full Length Human WDR83 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR83-331HCL | Recombinant Human WDR83 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDR83 Products
Required fields are marked with *
My Review for All WDR83 Products
Required fields are marked with *
0
Inquiry Basket