Recombinant Human WFDC10A Protein, SUMO&His-tagged
| Cat.No. : | WFDC10A-31H |
| Product Overview : | Recombinant Human WFDC10A Protein(Q9H1F0)(22-79 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 22-79 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 19 kDa |
| AASequence : | GYRDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHRDCQANNICCSTYCGNVCMSIL |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.1-1.0 mg/ml |
| ◆ Recombinant Proteins | ||
| WFDC10A-08HFL | Recombinant Full Length Human WFDC10A Protein, Flag tagged | +Inquiry |
| WFDC10A-31H | Recombinant Human WFDC10A Protein, SUMO&His-tagged | +Inquiry |
| WFDC10A-3742H | Recombinant Human WFDC10A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| WFDC10A-5024R | Recombinant Rhesus Macaque WFDC10A Protein, His (Fc)-Avi-tagged | +Inquiry |
| WFDC10A-5211R | Recombinant Rhesus monkey WFDC10A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WFDC10A-323HCL | Recombinant Human WFDC10A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WFDC10A Products
Required fields are marked with *
My Review for All WFDC10A Products
Required fields are marked with *
Recently Viewed
