Recombinant Human WFDC2 protein, His-tagged WFDC2-55H

Recombinant Human WFDC2 protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human WFDC2 protein, His-tagged

Recombinant Human WFDC2 protein, His-tagged

WFDC2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : WFDC2-55H
Product Overview : Recombinant Human WFDC2 fused with His tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : His
Form : lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa.
Molecular Mass : 13kD
AA Sequence : MKKGHHHHHHLVPRGSMPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADN LKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Purity : Greater than 95% by SDS-PAGE gel analyses.
Applications : Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
Storage : - 20°C for Lyophilized, - 80°C for Liquid
Gene Name : WFDC2 WAP four-disulfide core domain 2 [ Homo sapiens ]
Official Symbol : WFDC2
Synonyms : WFDC2; WAP four-disulfide core domain 2; WAP four-disulfide core domain protein 2; dJ461P17.6; EDDM4; epididymal protein 4; HE4; WAP5; epididymal secretory protein E4; putative protease inhibitor WAP5; WAP domain containing protein HE4-V4; major epididymis-specific protein E4; epididymis-specific, whey-acidic protein type, four-disulfide core; MGC57529;
Gene ID : 10406
mRNA Refseq : NM_006103
Protein Refseq : NP_006094
UniProt ID : Q14508
Chromosome Location : 20q12-q13.2
Function : endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy