Recombinant Human WFDC2 protein, His-tagged

• Cat.No.: WFDC2-55H
• Product Overview: Recombinant Human WFDC2 fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa.
• Molecular Mass: 13kD
• AA Sequence: MKKGHHHHHHLVPRGSMPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADN LKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
• Purity: Greater than 95% by SDS-PAGE gel analyses.
• Applications: Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
• Storage: - 20°C for Lyophilized, - 80°C for Liquid

Gene Information

• Gene Name: WFDC2 WAP four-disulfide core domain 2 [ Homo sapiens ]
• Official Symbol: WFDC2
• Synonyms: WFDC2; WAP four-disulfide core domain 2; WAP four-disulfide core domain protein 2; dJ461P17.6; EDDM4; epididymal protein 4; HE4; WAP5; epididymal secretory protein E4; putative protease inhibitor WAP5; WAP domain containing protein HE4-V4; major epididymis-specific protein E4; epididymis-specific, whey-acidic protein type, four-disulfide core; MGC57529
• Gene ID: 10406
• mRNA Refseq: NM_006103
• Protein Refseq: NP_006094
• UniProt ID: Q14508
• Chromosome Location: 20q12-q13.2
• Function: endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity