Recombinant Human WFDC2 protein, His-tagged

Cat.No. : WFDC2-55H
Product Overview : Recombinant Human WFDC2 fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Form : lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa.
Molecular Mass : 13kD
AA Sequence : MKKGHHHHHHLVPRGSMPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADN LKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Purity : Greater than 95% by SDS-PAGE gel analyses.
Applications : Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
Storage : - 20°C for Lyophilized, - 80°C for Liquid
Gene Name WFDC2 WAP four-disulfide core domain 2 [ Homo sapiens ]
Official Symbol WFDC2
Synonyms WFDC2; WAP four-disulfide core domain 2; WAP four-disulfide core domain protein 2; dJ461P17.6; EDDM4; epididymal protein 4; HE4; WAP5; epididymal secretory protein E4; putative protease inhibitor WAP5; WAP domain containing protein HE4-V4; major epididymis-specific protein E4; epididymis-specific, whey-acidic protein type, four-disulfide core; MGC57529;
Gene ID 10406
mRNA Refseq NM_006103
Protein Refseq NP_006094
MIM
UniProt ID Q14508
Chromosome Location 20q12-q13.2
Function endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WFDC2 Products

Required fields are marked with *

My Review for All WFDC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon