Recombinant Human WFDC9 protein, GST-tagged
Cat.No. : | WFDC9-301289H |
Product Overview : | Recombinant Human WFDC9 (24-63 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser24-Pro63 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SFWNKDPFLDMIRETEQCWVQPPYKYCEKRCTKIMTCVRP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | WFDC9 WAP four-disulfide core domain 9 [ Homo sapiens ] |
Official Symbol | WFDC9 |
Synonyms | WFDC9; WAP four-disulfide core domain 9; protein WFDC9; dJ688G8.2; WAP9; MGC126701; MGC126705; |
Gene ID | 259240 |
mRNA Refseq | NM_147198 |
Protein Refseq | NP_671731 |
UniProt ID | Q8NEX5 |
◆ Recombinant Proteins | ||
WFDC9-6588R | Recombinant Rat WFDC9 Protein | +Inquiry |
WFDC9-6244R | Recombinant Rat WFDC9 Protein, His (Fc)-Avi-tagged | +Inquiry |
WFDC9-18539M | Recombinant Mouse WFDC9 Protein | +Inquiry |
WFDC9-301289H | Recombinant Human WFDC9 protein, GST-tagged | +Inquiry |
WFDC9-10171M | Recombinant Mouse WFDC9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFDC9-317HCL | Recombinant Human WFDC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WFDC9 Products
Required fields are marked with *
My Review for All WFDC9 Products
Required fields are marked with *