Recombinant Human WNK1 Protein, GST-tagged

Cat.No. : WNK1-5099H
Product Overview : Human HSN2 full-length ORF ( NP_998820.1, 1 a.a. - 434 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the WNK subfamily of serine/threonine protein kinases. The encoded protein may be a key regulator of blood pressure by controlling the transport of sodium and chloride ions. Mutations in this gene have been associated with pseudohypoaldosteronism type II and hereditary sensory neuropathy type II. Alternatively spliced transcript variants encoding different isoforms have been described but the full-length nature of all of them has yet to be determined.[provided by RefSeq, May 2010]
Molecular Mass : 73.5 kDa
AA Sequence : MYELLVLFMLIQPQSMAHPCGGTPTYPESQIFFPTIHERPVSFSPPPTCPPKVAISQRRKSTSFLEAQTHHFQPLLRTVGQSLLPPGGSPTNWTPEAVVMLGTTASRVTGESCEIQVHPMFEPSQVYSDYRPGLVLPEEAHYFIPQEAVYVAGVHYQARVAEQYEGIPYNSSVLSSPMKQIPEQKPVQGGPTSSSVFEFPSGQAFLVGHLQNLRLDSGLGPGSPLSSISAPISTDATRLKFHPVFVPHSAPAVLTHNNESRSNCVFEFHVHTPSSSSGEGGGILPQRVYRNRQVAVDLNQEELPPQSVGLHGYLQPVTEEKHNYHAPELTVSVVEPIGQNWPIGSPEYSSDSSQITSSDPSDFQSPPPTGGAAAPFGSDVSMPFIHLPQTVLQESPLFFCFPQGTTSQQVLTASFSSGGSALHPQVIGKLPQLF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name WNK1 WNK lysine deficient protein kinase 1 [ Homo sapiens (human) ]
Official Symbol WNK1
Synonyms WNK1; WNK lysine deficient protein kinase 1; KDP; PSK; p65; HSN2; HSAN2; PRKWNK1; PPP1R167; serine/threonine-protein kinase WNK1; WNK lysine deficient protein kinase 1 isoform; erythrocyte 65 kDa protein; prostate-derived sterile 20-like kinase; protein kinase with no lysine 1; protein phosphatase 1, regulatory subunit 167; serine/threonine-protein kinase WNK1 1; serine/threonine-protein kinase WNK1 2; EC 2.7.11.1
Gene ID 65125
mRNA Refseq NM_001184985
Protein Refseq NP_001171914
MIM 605232
UniProt ID Q9H4A3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WNK1 Products

Required fields are marked with *

My Review for All WNK1 Products

Required fields are marked with *

0
cart-icon