Recombinant Human Wnt family member 9A Protein, His tagged
Cat.No. : | WNT9A-001H |
Product Overview : | Recombinant Human Wnt family member 9A protein (48-92 aa & 231-304 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 48-92 aa & 231-304 aa |
Description : | The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is expressed in gastric cancer cell lines. The protein encoded by this gene shows 75 % amino acid identity to chicken Wnt14, which has been shown to play a central role in initiating synovial joint formation in the chick limb. This gene is clustered with another family member, WNT3A, in the chromosome 1q42 region. |
Molecular Mass : | 13 kDa |
AA Sequence : | MPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALERQLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCLAGRFHHHHHHHH |
Endotoxin : | < 2 EU/μg by LAL. |
Purity : | > 65 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.4 mg/mL |
Gene Name | WNT9A Wnt family member 9A [ Homo sapiens (human) ] |
Official Symbol | WNT9A |
Synonyms | WNT9A; Wnt family member 9A; WNT14; protein Wnt-9a; wingless-type MMTV integration site family, member 14; wingless-type MMTV integration site family, member 9A |
Gene ID | 7483 |
mRNA Refseq | NM_003395.2 |
Protein Refseq | NP_003386.1 |
MIM | 602863 |
UniProt ID | O14904 |
◆ Recombinant Proteins | ||
WNT9A-125H | Active Recombinant Human WNT9A Protein | +Inquiry |
WNT9A-001H | Recombinant Human Wnt family member 9A Protein, His tagged | +Inquiry |
WNT9A-6540C | Recombinant Chicken WNT9A | +Inquiry |
WNT9A-4340Z | Recombinant Zebrafish WNT9A | +Inquiry |
WNT9A-10202M | Recombinant Mouse WNT9A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT9A-285HCL | Recombinant Human WNT9A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT9A Products
Required fields are marked with *
My Review for All WNT9A Products
Required fields are marked with *
0
Inquiry Basket