Recombinant Human Wnt family member 9A Protein, His tagged

Cat.No. : WNT9A-001H
Product Overview : Recombinant Human Wnt family member 9A protein (48-92 aa & 231-304 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 48-92 aa & 231-304 aa
Description : The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is expressed in gastric cancer cell lines. The protein encoded by this gene shows 75 % amino acid identity to chicken Wnt14, which has been shown to play a central role in initiating synovial joint formation in the chick limb. This gene is clustered with another family member, WNT3A, in the chromosome 1q42 region.
Molecular Mass : 13 kDa
AA Sequence : MPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALERQLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCLAGRFHHHHHHHH
Endotoxin : < 2 EU/μg by LAL.
Purity : > 65 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.4 mg/mL
Gene Name WNT9A Wnt family member 9A [ Homo sapiens (human) ]
Official Symbol WNT9A
Synonyms WNT9A; Wnt family member 9A; WNT14; protein Wnt-9a; wingless-type MMTV integration site family, member 14; wingless-type MMTV integration site family, member 9A
Gene ID 7483
mRNA Refseq NM_003395.2
Protein Refseq NP_003386.1
MIM 602863
UniProt ID O14904

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WNT9A Products

Required fields are marked with *

My Review for All WNT9A Products

Required fields are marked with *

0
cart-icon