Recombinant Human WNT1 protein, His-tagged
Cat.No. : | WNT1-7866H |
Product Overview : | Recombinant Human WNT1 protein(106-197 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 106-197 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | TAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFL |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | WNT1 wingless-type MMTV integration site family, member 1 [ Homo sapiens ] |
Official Symbol | WNT1 |
Synonyms | WNT1; wingless-type MMTV integration site family, member 1; INT1; proto-oncogene Wnt-1; proto-oncogene Int-1 homolog; wingless-type MMTV integration site family, member 1 (oncogene INT1); |
mRNA Refseq | NM_005430 |
Protein Refseq | NP_005421 |
MIM | 164820 |
UniProt ID | P04628 |
Gene ID | 7471 |
◆ Recombinant Proteins | ||
WNT1-7867H | Recombinant Human WNT1 protein, GST-tagged | +Inquiry |
WNT1-110H | Recombinant Human WNT1 Protein | +Inquiry |
WNT1-204H | Recombinant Human WNT1, StrepII-tagged | +Inquiry |
WNT1-7866H | Recombinant Human WNT1 protein, His-tagged | +Inquiry |
WNT1-5621H | Recombinant Human WNT1 protein, His-GST&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT1-304HCL | Recombinant Human WNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT1 Products
Required fields are marked with *
My Review for All WNT1 Products
Required fields are marked with *
0
Inquiry Basket