Recombinant Human WNT2B protein, GST-tagged

• Cat.No.: WNT2B-301263H
• Product Overview: Recombinant Human WNT2B (253-297 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Arg253-Thr297
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: RALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: WNT2B wingless-type MMTV integration site family, member 2B [ Homo sapiens ]
• Official Symbol: WNT2B
• Synonyms: WNT2B; wingless-type MMTV integration site family, member 2B; WNT13; protein Wnt-2b; wingless type MMTV integration site family; member 13; XWNT2; Xenopus; homolog of; XWNT2, Xenopus, homolog of; wingless-type MMTV integration site family, member 13
• Gene ID: 7482
• mRNA Refseq: NM_004185
• Protein Refseq: NP_004176
• MIM: 601968
• UniProt ID: Q93097