Recombinant Human WNT2B protein, GST-tagged
Cat.No. : | WNT2B-301263H |
Product Overview : | Recombinant Human WNT2B (253-297 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Arg253-Thr297 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | RALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | WNT2B wingless-type MMTV integration site family, member 2B [ Homo sapiens ] |
Official Symbol | WNT2B |
Synonyms | WNT2B; wingless-type MMTV integration site family, member 2B; WNT13; protein Wnt-2b; wingless type MMTV integration site family; member 13; XWNT2; Xenopus; homolog of; XWNT2, Xenopus, homolog of; wingless-type MMTV integration site family, member 13; |
Gene ID | 7482 |
mRNA Refseq | NM_004185 |
Protein Refseq | NP_004176 |
MIM | 601968 |
UniProt ID | Q93097 |
◆ Recombinant Proteins | ||
WNT2B-06H | Recombinant Full Length Human WNT2B Protein, His&GST tagged | +Inquiry |
WNT2B-2567H | Recombinant Human WNT2B Protein (1-391 aa), His-tagged | +Inquiry |
WNT2B-10195M | Recombinant Mouse WNT2B Protein, His (Fc)-Avi-tagged | +Inquiry |
WNT2B-1892H | Recombinant Human WNT2B protein, His & GST-tagged | +Inquiry |
WNT2B-3339H | Recombinant Human WNT2B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT2B-297HCL | Recombinant Human WNT2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT2B Products
Required fields are marked with *
My Review for All WNT2B Products
Required fields are marked with *