Recombinant Human WNT3, GST-tagged

Cat.No. : WNT3-5161H
Product Overview : Recombinant Human WNT3 encoding human full-length ORF(1 a.a. - 385 a.a.), fused a GST-tag at N-treminal was expressed in Wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : WNT3 belongs to the Wnt family of signaling proteins that play a key role in maintaining the integrity of embryonic and adult tissues. Expression of WNT3 occurs primarily along the dorsal midline across overlapping regions of the Central Nervous System (CNS). WNT3 signaling is essential for various morphogenetic events including embryonic patterning, cell determination, cell proliferation, CNS development, and cytoskeletal formation.
Purification : Glutathione Sepharose 4 Fast Flow
Formulation : Liquid. 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Sequence : MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKL GIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPP GEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKT CWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETG SFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : WNT3
Gene Name WNT3 wingless-type MMTV integration site family, member 3 [ Homo sapiens ]
Synonyms wingless-type MMTV integration site family, member 3; INT4; Proto-oncogene Int-4 homolog; MGC131950; MGC138321; MGC138323; Proto oncogene Int 4 homolog; Proto oncogene Wnt 3; Wnt 3 proto oncogene protein; WNT 3 proto oncogene protein precursor
Gene ID 7473
mRNA Refseq NM_030753.3
Protein Refseq NP_110380.1
MIM 165330
UniProt ID P56703
Chromosome Location 17q21
Pathway Basal cell carcinoma; Class B/2 (Secretin family receptors); DNA damage response (only ATM dependent); GPCR ligand binding; HTLV-I infection; Hedgehog signaling pathway; Melanogenesis; Pathways in cancer; Signaling by GPCR; Wnt Signaling Pathway; Wnt Signaling Pathway Net-Path; Wnt Signaling Pathway and Pluripotency; Wnt signaling network
Function Frizzled binding; Frizzled-2 binding; Protein domain specific binding; receptor agonist activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Wnt3 Products

Required fields are marked with *

My Review for All Wnt3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon