Recombinant Human WNT3A protein, His-tagged
| Cat.No. : | WNT3A-6765H |
| Product Overview : | Recombinant Human WNT3A protein(250-350 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Tag : | His |
| Protein Length : | 250-350 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | RGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT |
| Gene Name | WNT3A wingless-type MMTV integration site family, member 3A [ Homo sapiens ] |
| Official Symbol | WNT3A |
| Synonyms | WNT3A; wingless-type MMTV integration site family, member 3A; protein Wnt-3a; MGC119418; MGC119419; MGC119420; |
| Gene ID | 89780 |
| mRNA Refseq | NM_033131 |
| Protein Refseq | NP_149122 |
| MIM | 606359 |
| UniProt ID | P56704 |
| ◆ Recombinant Proteins | ||
| WNT3A-6744H | Recombinant Human WNT3A protein, GST-tagged | +Inquiry |
| WNT3A-186H | Active Recombinant Human WNT3A Surrogate Protein, Fc-tagged, For Organoid Culture | +Inquiry |
| Wnt3a-456M | Active Recombinant Mouse Wnt3a protein | +Inquiry |
| WNT3A-1700H | Recombinant Human WNT3A | +Inquiry |
| Wnt3a-585M | Recombinant Mouse Wnt3a Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WNT3A-295HCL | Recombinant Human WNT3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT3A Products
Required fields are marked with *
My Review for All WNT3A Products
Required fields are marked with *
