Recombinant Human WT1-AS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | WT1-AS-2098H |
Product Overview : | WIT1 MS Standard C13 and N15-labeled recombinant protein (NP_056939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at chromosome 11p13 may contribute to tumorigenesis. |
Molecular Mass : | 9.9 kDa |
AA Sequence : | MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | WT1-AS WT1 antisense RNA [ Homo sapiens (human) ] |
Official Symbol | WT1-AS |
Synonyms | WT1-AS; WT1 antisense RNA; WIT1; WIT-1; WT1AS; WT1-AS1; MGC120207; MGC120208; MGC120209 |
Gene ID | 51352 |
mRNA Refseq | NM_015855 |
Protein Refseq | NP_056939 |
MIM | 607899 |
UniProt ID | Q06250 |
◆ Recombinant Proteins | ||
WT1-AS-2098H | Recombinant Human WT1-AS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WT1-AS Products
Required fields are marked with *
My Review for All WT1-AS Products
Required fields are marked with *
0
Inquiry Basket