Recombinant Human WT1-AS Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : WT1-AS-2098H
Product Overview : WIT1 MS Standard C13 and N15-labeled recombinant protein (NP_056939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at chromosome 11p13 may contribute to tumorigenesis.
Molecular Mass : 9.9 kDa
AA Sequence : MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHLTERGAGLLQPQPQGPVRTPGPPSGSHPAAADNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name WT1-AS WT1 antisense RNA [ Homo sapiens (human) ]
Official Symbol WT1-AS
Synonyms WT1-AS; WT1 antisense RNA; WIT1; WIT-1; WT1AS; WT1-AS1; MGC120207; MGC120208; MGC120209
Gene ID 51352
mRNA Refseq NM_015855
Protein Refseq NP_056939
MIM 607899
UniProt ID Q06250

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WT1-AS Products

Required fields are marked with *

My Review for All WT1-AS Products

Required fields are marked with *

0
cart-icon