Recombinant Human WTAP protein, T7-tagged
Cat.No. : | WTAP-186H |
Product Overview : | Recombinant human WTAP (151aa, Isoform-II) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 151 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKL EQAQNELSAWKFTPDR |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | WTAP Wilms tumor 1 associated protein [ Homo sapiens ] |
Official Symbol | WTAP |
Synonyms | WTAP; Wilms tumor 1 associated protein; pre-mRNA-splicing regulator WTAP; KIAA0105; MGC3925; hFL(2)D; PNAS-132; WT1-associated protein; female-lethal(2)D homolog; wilms tumor 1-associating protein; Wilms tumour 1-associating protein; putative pre-mRNA splicing regulator female-lethal(2D); DKFZp686F20131; |
Gene ID | 9589 |
mRNA Refseq | NM_004906 |
Protein Refseq | NP_004897 |
MIM | 605442 |
UniProt ID | Q15007 |
Chromosome Location | 6q25-q27 |
◆ Recombinant Proteins | ||
WTAP-1453H | Recombinant Human WTAP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WTAP-18591M | Recombinant Mouse WTAP Protein | +Inquiry |
WTAP-447H | Recombinant Human WTAP Protein, His-tagged | +Inquiry |
WTAP-3014H | Recombinant Human Wilms Tumor 1 Associated Protein, T7-tagged | +Inquiry |
WTAP-6710H | Recombinant Human WTAP Protein (Met1-Asp150), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WTAP-276HCL | Recombinant Human WTAP 293 Cell Lysate | +Inquiry |
WTAP-277HCL | Recombinant Human WTAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WTAP Products
Required fields are marked with *
My Review for All WTAP Products
Required fields are marked with *