Recombinant Human WTAP protein, T7-tagged

Cat.No. : WTAP-186H
Product Overview : Recombinant human WTAP (151aa, Isoform-II) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 151 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKL EQAQNELSAWKFTPDR
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name WTAP Wilms tumor 1 associated protein [ Homo sapiens ]
Official Symbol WTAP
Synonyms WTAP; Wilms tumor 1 associated protein; pre-mRNA-splicing regulator WTAP; KIAA0105; MGC3925; hFL(2)D; PNAS-132; WT1-associated protein; female-lethal(2)D homolog; wilms tumor 1-associating protein; Wilms tumour 1-associating protein; putative pre-mRNA splicing regulator female-lethal(2D); DKFZp686F20131;
Gene ID 9589
mRNA Refseq NM_004906
Protein Refseq NP_004897
MIM 605442
UniProt ID Q15007
Chromosome Location 6q25-q27

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WTAP Products

Required fields are marked with *

My Review for All WTAP Products

Required fields are marked with *

0
cart-icon