Recombinant Human XAGE2B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : XAGE2B-4841H
Product Overview : XAGE2B MS Standard C13 and N15-labeled recombinant protein (NP_001073006) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens.
Molecular Mass : 12.4 kDa
AA Sequence : MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name XAGE2B X antigen family, member 2B [ Homo sapiens (human) ]
Official Symbol XAGE2B
Synonyms XAGE2B; X antigen family, member 2B; XAGE-2; X antigen family, member 2B; CT12.2; X antigen family member 2; cancer/testis antigen 12.2; g antigen family D member 3
Gene ID 728242
mRNA Refseq NM_001079538
Protein Refseq NP_001073006

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XAGE2B Products

Required fields are marked with *

My Review for All XAGE2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon