Recombinant Human XAGE2B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: XAGE2B-4841H
• Product Overview: XAGE2B MS Standard C13 and N15-labeled recombinant protein (NP_001073006) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens.
• Molecular Mass: 12.4 kDa
• AA Sequence: MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: XAGE2B X antigen family, member 2B [ Homo sapiens (human) ]
• Official Symbol: XAGE2B
• Synonyms: XAGE2B; X antigen family, member 2B; XAGE-2; X antigen family, member 2B; CT12.2; X antigen family member 2; cancer/testis antigen 12.2; g antigen family D member 3
• Gene ID: 728242
• mRNA Refseq: NM_001079538
• Protein Refseq: NP_001073006