Recombinant Human XAGE3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : XAGE3-3833H
Product Overview : XAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_573440) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is expressed in placenta and fetal liver/spleen, and may function in inhibiting cancer cell growth. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. Alternative splicing of this gene generates 2 transcript variants differing in the 5' UTR.
Molecular Mass : 12.3 kDa
AA Sequence : MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADLQELSQSKTGGECGNGPDDQGKILPKSEQFKMPEGGDRQPQVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name XAGE3 X antigen family member 3 [ Homo sapiens (human) ]
Official Symbol XAGE3
Synonyms XAGE3; X antigen family member 3; PLAC6; GAGED4; XAGE-3; pp9012; CT12.3a; CT12.3b; X antigen family member 3; CT12.3; G antigen, family D, 4; cancer/testis antigen 12.3; cancer/testis antigen family 12, member 3a; cancer/testis antigen family 12, member 3b; g antigen family D member 4; placenta-specific 6; placenta-specific gene 6 protein; protein XAGE-3
Gene ID 170626
mRNA Refseq NM_133179
Protein Refseq NP_573440
MIM 300740
UniProt ID Q8WTP9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XAGE3 Products

Required fields are marked with *

My Review for All XAGE3 Products

Required fields are marked with *

0
cart-icon