Recombinant Human XCL1 protein, His/Fc-tagged

Cat.No. : XCL1-06H
Product Overview : Recombinant Human XCL1(Val22-Gly114) fused with His/Fc tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : Val22-Gly114
Description : Lymphotactin, also known as ATAC, C motif chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible cytokine C1, XC chemokine ligand 1, LTN, SCYC1 and XCL1, is a secreted protein which belongs to the intercrine gamma family. It is also a member of the XC chemokine family. XCL1 is found in spleen with highest level, lower in peripheral leukocytes and very low levels in lung, colon and small intestine. XCL1 plays a role in inflammatory and immunological responses, inducing leukocyte migration and activation. XCL1 induces chemotactic function by binding to a chemokine receptor called XCR1. XCL1 is closely related to another chemokine called XCL2.
Form : Lyophilized from a 0.2 μm filtered solution of PBS
AA Sequence : VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDR KSNTRNNMIQTKPTGTQQSTNTAVTLTGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGKHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name XCL1 chemokine (C motif) ligand 1 [ Homo sapiens ]
Official Symbol XCL1
Synonyms XCL1; chemokine (C motif) ligand 1; LTN, SCYC1, small inducible cytokine subfamily C, member 1 (lymphotactin); lymphotactin; ATAC; LPTN; SCM 1; SCM 1a; SCM-1-alpha; lymphotaxin; cytokine SCM-1; c motif chemokine 1; XC chemokine ligand 1; single cysteine motif 1a; small-inducible cytokine C1; small inducible cytokine subfamily C, member 1 (lymphotactin); LTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a;
Gene ID 6375
mRNA Refseq NM_002995
Protein Refseq NP_002986
MIM 600250
UniProt ID P47992
Chromosome Location 1q24.2
Pathway Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; G alpha (q) signalling events, organism-specific biosystem;
Function chemokine activity; chemokine receptor binding; chemokine receptor binding; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XCL1 Products

Required fields are marked with *

My Review for All XCL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon