"XCL1" Related Products

Expand
Expand
Expand

Recombinant Human XCL1 protein, His/Fc-tagged

Cat.No.: XCL1-06H
Product Overview: Recombinant Human XCL1(Val22-Gly114) fused with His/Fc tag at C-terminal was expressed in HEK293.
Description: Lymphotactin, also known as ATAC, C motif chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible cytokine C1, XC chemokine ligand 1, LTN, SCYC1 and XCL1, is a secreted protein which belongs to the intercrine gamma family. It is also a member of the XC chemokine family. XCL1 is found in spleen with highest level, lower in peripheral leukocytes and very low levels in lung, colon and small intestine. XCL1 plays a role in inflammatory and immunological responses, inducing leukocyte migration and activation. XCL1 induces chemotactic function by binding to a chemokine receptor called XCR1. XCL1 is closely related to another chemokine called XCL2.
Source: HEK293
Species: Human
Tag: His/Fc
Form: Lyophilized from a 0.2 μm filtered solution of PBS
Protein length: Val22-Gly114
AA Sequence: VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDR KSNTRNNMIQTKPTGTQQSTNTAVTLTGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGKHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: XCL1 chemokine (C motif) ligand 1 [ Homo sapiens ]
Official Symbol: XCL1
Synonyms: XCL1; chemokine (C motif) ligand 1; LTN, SCYC1, small inducible cytokine subfamily C, member 1 (lymphotactin); lymphotactin; ATAC; LPTN; SCM 1; SCM 1a; SCM-1-alpha; lymphotaxin; cytokine SCM-1; c motif chemokine 1; XC chemokine ligand 1; single cysteine motif 1a; small-inducible cytokine C1; small inducible cytokine subfamily C, member 1 (lymphotactin); LTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a;
Gene ID: 6375
mRNA Refseq: NM_002995
Protein Refseq: NP_002986
MIM: 600250
UniProt ID: P47992
Chromosome Location: 1q24.2
Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; G alpha (q) signalling events, organism-specific biosystem;
Function: chemokine activity; chemokine receptor binding; chemokine receptor binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.