Recombinant Human XCL1 protein, His/Fc-tagged XCL1-06H

Recombinant Human XCL1 protein, His/Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human XCL1 protein, His/Fc-tagged

Recombinant Human XCL1 protein, His/Fc-tagged

XCL1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : XCL1-06H
Product Overview : Recombinant Human XCL1(Val22-Gly114) fused with His/Fc tag at C-terminal was expressed in HEK293.
Description : Lymphotactin, also known as ATAC, C motif chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible cytokine C1, XC chemokine ligand 1, LTN, SCYC1 and XCL1, is a secreted protein which belongs to the intercrine gamma family. It is also a member of the XC chemokine family. XCL1 is found in spleen with highest level, lower in peripheral leukocytes and very low levels in lung, colon and small intestine. XCL1 plays a role in inflammatory and immunological responses, inducing leukocyte migration and activation. XCL1 induces chemotactic function by binding to a chemokine receptor called XCR1. XCL1 is closely related to another chemokine called XCL2.
Source : HEK293
Species : Human
Tag : His/Fc
Form : Lyophilized from a 0.2 μm filtered solution of PBS
Protein length : Val22-Gly114
AA Sequence : VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDR KSNTRNNMIQTKPTGTQQSTNTAVTLTGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGKHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name : XCL1 chemokine (C motif) ligand 1 [ Homo sapiens ]
Official Symbol : XCL1
Synonyms : XCL1; chemokine (C motif) ligand 1; LTN, SCYC1, small inducible cytokine subfamily C, member 1 (lymphotactin); lymphotactin; ATAC; LPTN; SCM 1; SCM 1a; SCM-1-alpha; lymphotaxin; cytokine SCM-1; c motif chemokine 1; XC chemokine ligand 1; single cysteine motif 1a; small-inducible cytokine C1; small inducible cytokine subfamily C, member 1 (lymphotactin); LTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a;
Gene ID : 6375
mRNA Refseq : NM_002995
Protein Refseq : NP_002986
MIM : 600250
UniProt ID : P47992
Chromosome Location : 1q24.2
Pathway : Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; G alpha (q) signalling events, organism-specific biosystem;
Function : chemokine activity; chemokine receptor binding; chemokine receptor binding; protein homodimerization activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy