Recombinant Human XRCC5, His-tagged
Cat.No. : | XRCC5-29197TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 345-657 of Human Ku80 with an N terminal His tag. Predicted MWt: 37 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 345-657 a.a. |
Description : | The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events.This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 98 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHAL DDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYV QLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDS MSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALH PREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFP LIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHF SVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASN QLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQR FNN |
Sequence Similarities : | Belongs to the ku80 family.Contains 1 Ku domain. |
Gene Name | XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) [ Homo sapiens ] |
Official Symbol | XRCC5 |
Synonyms | XRCC5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining; Ku autoantigen, 80kD); X-ray repair cross |
Gene ID | 7520 |
mRNA Refseq | NM_021141 |
Protein Refseq | NP_066964 |
MIM | 194364 |
Uniprot ID | P13010 |
Chromosome Location | 2q35 |
Pathway | 2-LTR circle formation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; DNA Repair, organism-specific biosystem; DNA-PK complex, organism-specific biosystem; |
Function | contributes_to 5-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; double-stranded DNA binding; |
◆ Recombinant Proteins | ||
XRCC5-3758H | Recombinant Human XRCC5, GST-tagged | +Inquiry |
XRCC5-29197TH | Recombinant Human XRCC5, His-tagged | +Inquiry |
Xrcc5-8229M | Recombinant Mouse Xrcc5 protein, His & T7-tagged | +Inquiry |
XRCC5-149H | Recombinant Human XRCC5 protein, His-tagged | +Inquiry |
XRCC5-6579H | Recombinant Human XRCC5 Protein (Leu384-Ile732), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XRCC5-254HCL | Recombinant Human XRCC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XRCC5 Products
Required fields are marked with *
My Review for All XRCC5 Products
Required fields are marked with *