Recombinant Human XRCC5 protein, His-tagged
Cat.No. : | XRCC5-3556H |
Product Overview : | Recombinant Human XRCC5 protein(384-732 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 384-732 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) [ Homo sapiens ] |
Official Symbol | XRCC5 |
Synonyms | XRCC5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining; Ku autoantigen, 80kD); X-ray repair cross-complementing protein 5; KARP 1; Ku autoantigen; 80kDa; KU80; Ku86; KUB2; TLAA; CTC85; CTCBF; nuclear factor IV; Ku autoantigen, 80kDa; DNA repair protein XRCC5; thyroid-lupus autoantigen; 86 kDa subunit of Ku antigen; lupus Ku autoantigen protein p86; Ku86 autoantigen related protein 1; CTC box-binding factor 85 kDa subunit; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; NFIV; KARP1; KARP-1; FLJ39089; |
Gene ID | 7520 |
mRNA Refseq | NM_021141 |
Protein Refseq | NP_066964 |
MIM | 194364 |
UniProt ID | P13010 |
◆ Recombinant Proteins | ||
Xrcc5-8229M | Recombinant Mouse Xrcc5 protein, His & T7-tagged | +Inquiry |
XRCC5-3758H | Recombinant Human XRCC5, GST-tagged | +Inquiry |
XRCC5-2317Z | Recombinant Zebrafish XRCC5 | +Inquiry |
XRCC5-8228H | Recombinant Human XRCC5 protein, His-tagged | +Inquiry |
XRCC5-2646H | Recombinant Human XRCC5 protein(571-730 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XRCC5-254HCL | Recombinant Human XRCC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XRCC5 Products
Required fields are marked with *
My Review for All XRCC5 Products
Required fields are marked with *
0
Inquiry Basket